Sequence (1LC)
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-CONH2
Sequence (3LC)
H - Lys - Trp - Lys - Leu - Phe - Lys - Lys - Ile - Glu - Lys - Val - Gly - Gln - Asn - Ile - Arg - Asp - Gly - Ile - Ile - Lys - Ala - Gly - Pro - Ala - Val - Ala - Val - Val - Gly - Gln - Ala - Thr - Gln - Ile - Ala - Lys - CONH2
Format
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
Description
C-terminus is amidated.
Storage
Store the peptide at -20°C.
Product Usage
This product is for research use only. Not for use in diagnostic or therapeutic procedures.